PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004489482.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 339aa    MW: 38550.3 Da    PI: 6.5958
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004489482.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v  +G g+W++++++ g++R++k+c++rw +yl
   XP_004489482.1 14 RGLWTPEEDAKILAYVSNHGIGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding476.1e-1569110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T +E+el++ +++  G++ W++Ia++++ gRt++++k++w++
   XP_004489482.1  69 SFTLQEEELIISLHEAIGSR-WSLIAKRLP-GRTDNDVKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.829965IPR017930Myb domain
SuperFamilySSF466892.16E-3011108IPR009057Homeodomain-like
SMARTSM007176.1E-141363IPR001005SANT/Myb domain
PfamPF002491.5E-151461IPR001005SANT/Myb domain
CDDcd001676.04E-111761No hitNo description
Gene3DG3DSA:1.10.10.608.3E-2465116IPR009057Homeodomain-like
SMARTSM007174.7E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129417.9366116IPR017930Myb domain
CDDcd001672.00E-1069112No hitNo description
PfamPF002491.1E-1369110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPE EDAKILAYVS NHGIGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDSF TLQEEELIIS LHEAIGSRWS LIAKRLPGRT DNDVKNYWNT KLRKKLMKMG  120
IDPITHKPVS QVLSDLGSIS SLSKNENLMM KNMIPTRIEP SNSKKNLILE QKQEEQAQPL  180
EHQVQYHQVQ HVLSEVASSS SSTSSSNLTR LNLPNSYSCN KTSSQAQMNP TCSSFDWSEF  240
LHSDDPFMFQ ELQQCDIQRV MSSLNFSSLM QSEGEIFNDS NSKLASEDFD DVDCVASKEY  300
QINNQFDQGH SFSGNSFVDG ILNKDSEIIK ATFPYTFDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1474994e-58AC147499.5 Medicago truncatula chromosome 6 clone mth2-22h5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489482.10.0PREDICTED: myb-related protein 308
SwissprotQ9LSI72e-83MYB35_ARATH; Transcription factor MYB35
TrEMBLG7KK081e-156G7KK08_MEDTR; Myb transcription factor
STRINGGLYMA13G04920.11e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.15e-81MYB family protein